| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344243.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| PLSRQCKVLVNIQQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRQDGTCLWLTPDGKTQVTAEYYNENGAMVPIRVHTVLISTQHD* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,594.045 | ||
| Theoretical pI: | 5.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 46.436 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.211 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344243.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| PLSRQCKVLVNIQQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRQDGTCLWLTPDGKTQVTAEYYNENGAMVPIRVHTVLISTQHD* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,594.045 | ||
| Theoretical pI: | 5.809 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 46.436 | ||
| aromaticity | 0.053 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.211 | ||
| sheet | 0.228 | ||