Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344253.1 | 5prime_partial | 220 | 793-131(-) |
Amino Acid sequence : | |||
AQVILVSVNYRLALEFPLPTAYEDSWAALQWVAHHFKIPGGYAVEIPMRHNVDFDRIFLAGDSAGANISHHLLMRVGSGGQELGEMKINGVVMVHPYFWGEEAMGAEAENPVFKAVVDKW WRFVCTSDRGCDDPWINPFVAGAPSLAGLGCERALVCVAGNDVLRERGRFYYKGLKESGWRGRVECLESQGEDHVFHIMDPTSESSRILIQRCAEFINQH* | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 15,715.032 | ||
Theoretical pI: | 9.235 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.897 | ||
aromaticity | 0.028 | ||
GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.246 | ||
sheet | 0.261 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344253.1 | complete | 142 | 134-562(+) |
Amino Acid sequence : | |||
MLVDEFRTSLDQNPRTLGSRIHDMEYMILSLALQTLHPPSPSTLLQTLVIKSTPLTQNIIPGHANKGPLATQTRQTRSPGHKGVDPRVIAAAIGGAHKSPPLIHHRLENRILCLGSHCLF APEIRMDHHNTIDLHLAQFLTP* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,715.032 | ||
Theoretical pI: | 9.235 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 50.897 | ||
aromaticity | 0.028 | ||
GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.246 | ||
sheet | 0.261 |