| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344253.1 | 5prime_partial | 220 | 793-131(-) |
Amino Acid sequence : | |||
| AQVILVSVNYRLALEFPLPTAYEDSWAALQWVAHHFKIPGGYAVEIPMRHNVDFDRIFLAGDSAGANISHHLLMRVGSGGQELGEMKINGVVMVHPYFWGEEAMGAEAENPVFKAVVDKW WRFVCTSDRGCDDPWINPFVAGAPSLAGLGCERALVCVAGNDVLRERGRFYYKGLKESGWRGRVECLESQGEDHVFHIMDPTSESSRILIQRCAEFINQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 15,715.032 | ||
| Theoretical pI: | 9.235 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 50.897 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.246 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344253.1 | complete | 142 | 134-562(+) |
Amino Acid sequence : | |||
| MLVDEFRTSLDQNPRTLGSRIHDMEYMILSLALQTLHPPSPSTLLQTLVIKSTPLTQNIIPGHANKGPLATQTRQTRSPGHKGVDPRVIAAAIGGAHKSPPLIHHRLENRILCLGSHCLF APEIRMDHHNTIDLHLAQFLTP* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,715.032 | ||
| Theoretical pI: | 9.235 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 50.897 | ||
| aromaticity | 0.028 | ||
| GRAVY | -0.209 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.246 | ||
| sheet | 0.261 | ||