Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344258.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
PLKSPPPPPPKMDLPLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDI FTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDTRFES | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 11,802.016 | ||
Theoretical pI: | 11.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 109.724 | ||
aromaticity | 0.028 | ||
GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.302 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344258.1 | 5prime_partial | 206 | 624-4(-) |
Amino Acid sequence : | |||
TLKPCIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDE VALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEGKIHFRWWWWWRF* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 11,802.016 | ||
Theoretical pI: | 11.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 109.724 | ||
aromaticity | 0.028 | ||
GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.302 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344258.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
LKISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,802.016 | ||
Theoretical pI: | 11.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 109.724 | ||
aromaticity | 0.028 | ||
GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.302 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344258.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
PLKSPPPPPPKMDLPLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDI FTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDTRFES | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 11,802.016 | ||
Theoretical pI: | 11.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 109.724 | ||
aromaticity | 0.028 | ||
GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.302 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344258.1 | 5prime_partial | 206 | 624-4(-) |
Amino Acid sequence : | |||
TLKPCIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDE VALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEGKIHFRWWWWWRF* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 11,802.016 | ||
Theoretical pI: | 11.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 109.724 | ||
aromaticity | 0.028 | ||
GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.302 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344258.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
LKISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,802.016 | ||
Theoretical pI: | 11.844 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 109.724 | ||
aromaticity | 0.028 | ||
GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
Helix | 0.132 | ||
turn | 0.302 | ||
sheet | 0.255 |