| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344258.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| PLKSPPPPPPKMDLPLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDI FTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDTRFES | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 11,802.016 | ||
| Theoretical pI: | 11.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 109.724 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.132 | ||
| turn | 0.302 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344258.1 | 5prime_partial | 206 | 624-4(-) |
Amino Acid sequence : | |||
| TLKPCIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDE VALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEGKIHFRWWWWWRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,802.016 | ||
| Theoretical pI: | 11.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 109.724 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.132 | ||
| turn | 0.302 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344258.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
| LKISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,802.016 | ||
| Theoretical pI: | 11.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 109.724 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.132 | ||
| turn | 0.302 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344258.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| PLKSPPPPPPKMDLPLLEKTLLGVFFAIVVAAVVSKLRGRKFKLPPGPIPVPIFGNWLQVGDDLNHRNLTDYAKKFGDIFLLRMGQRNLVVVSSPDHAKEVLHTQGVEFGSRTRNVVFDI FTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRYGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDTRFES | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 11,802.016 | ||
| Theoretical pI: | 11.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 109.724 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.132 | ||
| turn | 0.302 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344258.1 | 5prime_partial | 206 | 624-4(-) |
Amino Acid sequence : | |||
| TLKPCIEHNPIHVVVHHQLQAPPQHYPVRRRLRILLHVIHDGGGLRLPPVAVLLHHLVGEKRNRHDPPHLPPVLAVNGEHHVLPLPGENIEHNIASSRAELNPLRVEDLLRVVRRRNDDE VALPHAEEENIAELLRVVGEIPVVEIVADLKPVSEDRHRNRPRRQLELPAAELRDHGGDDDGEEDAEKRLLEEGKIHFRWWWWWRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 11,802.016 | ||
| Theoretical pI: | 11.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 109.724 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.132 | ||
| turn | 0.302 | ||
| sheet | 0.255 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344258.1 | 5prime_partial | 106 | 3-323(+) |
Amino Acid sequence : | |||
| LKISTTTTTENGSSPPREDASRRLLRHRRRRRGLEAPRQEVQAAAGADSGADLRKLASSRRRSQPPESHRLREEVRRYFPPPHGAAQPRRRFVAGPREGGPPHAGG* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,802.016 | ||
| Theoretical pI: | 11.844 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 109.724 | ||
| aromaticity | 0.028 | ||
| GRAVY | -1.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.132 | ||
| turn | 0.302 | ||
| sheet | 0.255 | ||