| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344274.1 | internal | 218 | 1-654(+) |
Amino Acid sequence : | |||
| KQSPPPLEISTFRRPAPPCMATAVAVSGNQSYWDSIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIHLMHAAAHAHEHLPLTDGSRPDS KPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCRAAC | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 15,037.195 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 107.276 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344274.1 | 3prime_partial | 151 | 455-3(-) |
Amino Acid sequence : | |||
| MDRASSSNPNGAIPSPVRSSMLGLNLCWISGLESGLEPSVRGRCSWAWAAACMRCMAEAAAMAWLRWPPMSSQAATQRAEAVVAGAERVRWCMGSKTVSGDLIGMAFFRYELMSSWMESQ YDWLPETATAVAMQGGAGRRNVDISKGGGLC | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 15,037.195 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 107.276 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344274.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
| TKSPPLRNINIPPPSAALHGHRRRRLRQPIILGLHPGRHQLVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPHACGGPRPRAPPPHRRLQARFQ ARYPTQIQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 15,037.195 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 107.276 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344274.1 | internal | 218 | 1-654(+) |
Amino Acid sequence : | |||
| KQSPPPLEISTFRRPAPPCMATAVAVSGNQSYWDSIQDDINSYLKKAIPIRSPETVFEPMHHLTLSAPATTASALCVAACELIGGHRSQAIAAASAIHLMHAAAHAHEHLPLTDGSRPDS KPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQNQNPARILRVIIEISHAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCRAAC | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 15,037.195 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 107.276 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344274.1 | 3prime_partial | 151 | 455-3(-) |
Amino Acid sequence : | |||
| MDRASSSNPNGAIPSPVRSSMLGLNLCWISGLESGLEPSVRGRCSWAWAAACMRCMAEAAAMAWLRWPPMSSQAATQRAEAVVAGAERVRWCMGSKTVSGDLIGMAFFRYELMSSWMESQ YDWLPETATAVAMQGGAGRRNVDISKGGGLC | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 15,037.195 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 107.276 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344274.1 | 5prime_partial | 131 | 3-398(+) |
Amino Acid sequence : | |||
| TKSPPLRNINIPPPSAALHGHRRRRLRQPIILGLHPGRHQLVSEESHPNKIAGDGLRAHAPPHPLRPRHHRLRPLCGGLRAHRRPPEPSHRRRLRHTPHACGGPRPRAPPPHRRLQARFQ ARYPTQIQPQH* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 15,037.195 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 107.276 | ||
| aromaticity | 0.015 | ||
| GRAVY | -1.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.168 | ||
| turn | 0.313 | ||
| sheet | 0.198 | ||