Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344290.1 | 5prime_partial | 206 | 668-48(-) |
Amino Acid sequence : | |||
INDHNLTEGHDSEEAQKADDEEESNHPRQGRILNILSIVRYSRLFGDRFTHTKKVTSKSSAEGDAGRGDDASLNDGVLLPGKRLVENSRFVEKLCPRLHEEESEQASRHVERGDDPRRQI QLHHDEREQNPQHEAHHKRPQRQLLLPRRHLLALEYLLHRLFAVGRRSHTPLIFVAVGFLVDAGGAIHGFRFVNEGLVIMSGFYKL* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 13,448.474 | ||
Theoretical pI: | 9.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.919 | ||
aromaticity | 0.081 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.323 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344290.1 | 3prime_partial | 188 | 105-668(+) |
Amino Acid sequence : | |||
MDRSPSINKKTDGDEDERGVAAAANGEESVEKIFESKEVPSWQKQLTLRAFVVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLDKSGILNQPFTRQENTVIQTCVV ASSGIAFSGGFGSYLFGMSESIAKQSTVSDNAQNIKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIID | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 13,448.474 | ||
Theoretical pI: | 9.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.919 | ||
aromaticity | 0.081 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.323 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344290.1 | complete | 124 | 448-74(-) |
Amino Acid sequence : | |||
MTVFSCLVNGWLRIPDLSRNFVHVFTKKNPSRPADTLSEGMIPVVRFSFITMNVNRTPNTKLTTNALSVSCFCHDGTSLLSNIFSTDSSPLAAAATPLSSSSPSVFLLMLGERSMAFGLL MRAS* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,448.474 | ||
Theoretical pI: | 9.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.919 | ||
aromaticity | 0.081 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.323 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344290.1 | 5prime_partial | 206 | 668-48(-) |
Amino Acid sequence : | |||
INDHNLTEGHDSEEAQKADDEEESNHPRQGRILNILSIVRYSRLFGDRFTHTKKVTSKSSAEGDAGRGDDASLNDGVLLPGKRLVENSRFVEKLCPRLHEEESEQASRHVERGDDPRRQI QLHHDEREQNPQHEAHHKRPQRQLLLPRRHLLALEYLLHRLFAVGRRSHTPLIFVAVGFLVDAGGAIHGFRFVNEGLVIMSGFYKL* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 13,448.474 | ||
Theoretical pI: | 9.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.919 | ||
aromaticity | 0.081 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.323 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344290.1 | 3prime_partial | 188 | 105-668(+) |
Amino Acid sequence : | |||
MDRSPSINKKTDGDEDERGVAAAANGEESVEKIFESKEVPSWQKQLTLRAFVVSFVLGVLFTFIVMKLNLTTGIIPSLNVSAGLLGFFFVKTWTKFLDKSGILNQPFTRQENTVIQTCVV ASSGIAFSGGFGSYLFGMSESIAKQSTVSDNAQNIKDPSLSWMIGFLFVVSFLGLFAVVPLRKIMIID | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 13,448.474 | ||
Theoretical pI: | 9.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.919 | ||
aromaticity | 0.081 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.323 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344290.1 | complete | 124 | 448-74(-) |
Amino Acid sequence : | |||
MTVFSCLVNGWLRIPDLSRNFVHVFTKKNPSRPADTLSEGMIPVVRFSFITMNVNRTPNTKLTTNALSVSCFCHDGTSLLSNIFSTDSSPLAAAATPLSSSSPSVFLLMLGERSMAFGLL MRAS* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,448.474 | ||
Theoretical pI: | 9.493 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 48.919 | ||
aromaticity | 0.081 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.323 | ||
sheet | 0.250 |