Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344292.1 | 5prime_partial | 135 | 1-408(+) |
Amino Acid sequence : | |||
VVTNYVKPVVDDLMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAVFKGEKELEALGAATEEKDKVREFLDQVL VLDYALPASVQAASL* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,280.105 | ||
Theoretical pI: | 4.641 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 17.120 | ||
aromaticity | 0.067 | ||
GRAVY | 0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.200 | ||
sheet | 0.348 |