| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344292.1 | 5prime_partial | 135 | 1-408(+) |
Amino Acid sequence : | |||
| VVTNYVKPVVDDLMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAVFKGEKELEALGAATEEKDKVREFLDQVL VLDYALPASVQAASL* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,280.105 | ||
| Theoretical pI: | 4.641 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 17.120 | ||
| aromaticity | 0.067 | ||
| GRAVY | 0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.200 | ||
| sheet | 0.348 | ||