| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344294.1 | 5prime_partial | 185 | 1-558(+) |
Amino Acid sequence : | |||
| STTIPFPLFFLLSNFPTMDFLSGLAKGDDSKKTGDEKSTTELFASAKVVAEAAQAQFSNQPEKYDKAKAAGAAADILDAAEKYGKLDQTQGVGKYVDQAENYLRQYGTTPSAAGATPPAS GEEKPAPTATETSAPSDAKPSEGGAGDYLKKAEELLGKPSEGGEKKEAESGYGGLMNAASGFLNK* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,834.385 | ||
| Theoretical pI: | 11.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 141.058 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.292 | ||
| sheet | 0.152 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344294.1 | 5prime_partial | 178 | 3-539(+) |
Amino Acid sequence : | |||
| NNNSLSPIFSPLKFSDDGFLVRLSERRRLQEDRRRKVHNRALRQRQGGCRGGSSPVQQPAGEIRQGQSRRRRRRYPRRRREIRQARPDPRSGEIRRSSGELSPPVRHNPVRRRRHAPCFR RRKTCPHRHRNQCSVGRQAVGRRRRGLLEEGGGVAGKAVGRRREEGGGKWIWRSDECC* | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 20,834.385 | ||
| Theoretical pI: | 11.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12865 | ||
| Instability index: | 141.058 | ||
| aromaticity | 0.039 | ||
| GRAVY | -1.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.292 | ||
| sheet | 0.152 | ||