| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344305.1 | 5prime_partial | 233 | 3-704(+) |
Amino Acid sequence : | |||
| TPFAGSNLEATVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPEQAEVPPVAQPPAGGQPVNTTTQATQPAVPSGGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQA LRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,382.179 | ||
| Theoretical pI: | 4.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 54.684 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.258 | ||
| sheet | 0.343 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344305.1 | 5prime_partial | 233 | 3-704(+) |
Amino Acid sequence : | |||
| TPFAGSNLEATVQQILDMGGGSWDRDTVVRALRAAYNNPERAVEYLYSGIPEQAEVPPVAQPPAGGQPVNTTTQATQPAVPSGGPNANPLDLFPQGLPNMGSNAGAGTLDFLRNSQQFQA LRAMVQANPQILQPMLQELGKQNPQLVRLIQEHQADFLRLINEPVEGEGNILGQLAEAMPQAVTVTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFDE* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,382.179 | ||
| Theoretical pI: | 4.429 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 54.684 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.341 | ||
Secondary Structure Fraction | |||
| Helix | 0.262 | ||
| turn | 0.258 | ||
| sheet | 0.343 | ||