| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344307.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| HPFYLSVLQFVVHFPLSYLFVYILEWGVGGAMLALNFSQWVTIIGEFIYIFGGWCPDSWNGFSMAAFKDIFPVVKLSVASGLMVCLELWYYAILVLVAGYMKNAEVAISAFSICLNINGW EFMICLGILGAACVRVANELGRGDANAVRFAIKVLLSTSVAIGVLVWILCLVFGNQLGYLFTQEEAVATAVADLSVLLAFSVLFNSIYPVFSRVAVGAGM | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 24,030.215 | ||
| Theoretical pI: | 5.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52285 | ||
| Instability index: | 29.596 | ||
| aromaticity | 0.155 | ||
| GRAVY | 1.091 | ||
Secondary Structure Fraction | |||
| Helix | 0.482 | ||
| turn | 0.218 | ||
| sheet | 0.300 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344307.1 | internal | 220 | 2-661(+) |
Amino Acid sequence : | |||
| HPFYLSVLQFVVHFPLSYLFVYILEWGVGGAMLALNFSQWVTIIGEFIYIFGGWCPDSWNGFSMAAFKDIFPVVKLSVASGLMVCLELWYYAILVLVAGYMKNAEVAISAFSICLNINGW EFMICLGILGAACVRVANELGRGDANAVRFAIKVLLSTSVAIGVLVWILCLVFGNQLGYLFTQEEAVATAVADLSVLLAFSVLFNSIYPVFSRVAVGAGM | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 24,030.215 | ||
| Theoretical pI: | 5.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 51910 52285 | ||
| Instability index: | 29.596 | ||
| aromaticity | 0.155 | ||
| GRAVY | 1.091 | ||
Secondary Structure Fraction | |||
| Helix | 0.482 | ||
| turn | 0.218 | ||
| sheet | 0.300 | ||