| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344313.1 | internal | 213 | 2-640(+) |
Amino Acid sequence : | |||
| LYKLWVKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADALPYLGWLDLGGHEKRMKKAAKELDEVVGEWLAEHREREFSGEG KAQDFMDVMISVVKGADLQCEFDVDTIIKATCGAQQELDKHVGKDRRVKESDLNNLIYLQAIVKETLRLYPPGPLAGTRRFTEDCVVGGYYIP | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 24,103.478 | ||
| Theoretical pI: | 6.404 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
| Instability index: | 34.412 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.183 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344313.1 | internal | 213 | 2-640(+) |
Amino Acid sequence : | |||
| LYKLWVKKKSDGSGTEVGEGVVVDMKRWLGELNMNVVMRMVAGKRFGSGDNAEETKRCRRVMRDFFYLAGFFVPADALPYLGWLDLGGHEKRMKKAAKELDEVVGEWLAEHREREFSGEG KAQDFMDVMISVVKGADLQCEFDVDTIIKATCGAQQELDKHVGKDRRVKESDLNNLIYLQAIVKETLRLYPPGPLAGTRRFTEDCVVGGYYIP | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 24,103.478 | ||
| Theoretical pI: | 6.404 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32680 | ||
| Instability index: | 34.412 | ||
| aromaticity | 0.094 | ||
| GRAVY | -0.371 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.183 | ||
| sheet | 0.277 | ||