| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344315.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| QLHAQAWGPRPLYYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVRNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAGMLMWILHDWSDD KCIEI | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 13,507.099 | ||
| Theoretical pI: | 10.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 62.547 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.288 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344315.1 | 3prime_partial | 137 | 413-3(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVEWLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVIKGPWSPCLCMKL | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,507.099 | ||
| Theoretical pI: | 10.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 62.547 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.288 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344315.1 | 5prime_partial | 125 | 2-379(+) |
Amino Acid sequence : | |||
| STSCTSMGTTAPLLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRATLPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLS QVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,507.099 | ||
| Theoretical pI: | 10.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 62.547 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.288 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344315.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
| QLHAQAWGPRPLYYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVRNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAGMLMWILHDWSDD KCIEI | |||
Physicochemical properties | |||
| Number of amino acids: | 245 | ||
| Molecular weight: | 13,507.099 | ||
| Theoretical pI: | 10.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 62.547 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.288 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344315.1 | 3prime_partial | 137 | 413-3(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVEWLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVIKGPWSPCLCMKL | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,507.099 | ||
| Theoretical pI: | 10.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 62.547 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.288 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344315.1 | 5prime_partial | 125 | 2-379(+) |
Amino Acid sequence : | |||
| STSCTSMGTTAPLLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRATLPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLS QVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,507.099 | ||
| Theoretical pI: | 10.405 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 62.547 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
| Helix | 0.208 | ||
| turn | 0.288 | ||
| sheet | 0.264 | ||