Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344315.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
QLHAQAWGPRPLYYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVRNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAGMLMWILHDWSDD KCIEI | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 13,507.099 | ||
Theoretical pI: | 10.405 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 62.547 | ||
aromaticity | 0.016 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.288 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344315.1 | 3prime_partial | 137 | 413-3(-) |
Amino Acid sequence : | |||
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVEWLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVIKGPWSPCLCMKL | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,507.099 | ||
Theoretical pI: | 10.405 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 62.547 | ||
aromaticity | 0.016 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.288 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344315.1 | 5prime_partial | 125 | 2-379(+) |
Amino Acid sequence : | |||
STSCTSMGTTAPLLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRATLPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLS QVDQR* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,507.099 | ||
Theoretical pI: | 10.405 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 62.547 | ||
aromaticity | 0.016 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.288 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344315.1 | internal | 245 | 3-737(+) |
Amino Acid sequence : | |||
QLHAQAWGPRPLYYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLYL KSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVRNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAGMLMWILHDWSDD KCIEI | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 13,507.099 | ||
Theoretical pI: | 10.405 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 62.547 | ||
aromaticity | 0.016 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.288 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344315.1 | 3prime_partial | 137 | 413-3(-) |
Amino Acid sequence : | |||
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVEWLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVIKGPWSPCLCMKL | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,507.099 | ||
Theoretical pI: | 10.405 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 62.547 | ||
aromaticity | 0.016 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.288 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344315.1 | 5prime_partial | 125 | 2-379(+) |
Amino Acid sequence : | |||
STSCTSMGTTAPLLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRATLPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLS QVDQR* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,507.099 | ||
Theoretical pI: | 10.405 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 62.547 | ||
aromaticity | 0.016 | ||
GRAVY | -0.580 | ||
Secondary Structure Fraction | |||
Helix | 0.208 | ||
turn | 0.288 | ||
sheet | 0.264 |