| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344327.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
| DRIIPFHFFSPAHVMPLLEIVRTQKTSPQAIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAALLLVERGTDLYKIDKAITKFGMPMGPFRLCDLVGFGVAVATGGQFVLNFPERT YKSMLIPLMQEDKRAGETTRRGFYVYDEKRRANPDPEIKKYIEKAREISGVTIDPKLTKLSDKDIVEMIFFPVVNEACLVLEEGIAVKAADLDISAVM | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,434.459 | ||
| Theoretical pI: | 8.678 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 36.019 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.179 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344327.1 | internal | 218 | 3-656(+) |
Amino Acid sequence : | |||
| DRIIPFHFFSPAHVMPLLEIVRTQKTSPQAIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAALLLVERGTDLYKIDKAITKFGMPMGPFRLCDLVGFGVAVATGGQFVLNFPERT YKSMLIPLMQEDKRAGETTRRGFYVYDEKRRANPDPEIKKYIEKAREISGVTIDPKLTKLSDKDIVEMIFFPVVNEACLVLEEGIAVKAADLDISAVM | |||
Physicochemical properties | |||
| Number of amino acids: | 218 | ||
| Molecular weight: | 24,434.459 | ||
| Theoretical pI: | 8.678 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 36.019 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.179 | ||
| sheet | 0.252 | ||