| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344329.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
| RDWLVFLRNLTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQPGARVIITRNRSNLRSPS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,245.486 | ||
| Theoretical pI: | 9.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.746 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344329.1 | internal | 104 | 313-2(-) |
Amino Acid sequence : | |||
| AWRAQIGSISGDDHTSTGLFQGRGTTLPNITITTHNSHLSGNHYISSPHKSIRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSKVPQKHQPIS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,245.486 | ||
| Theoretical pI: | 9.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.746 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344329.1 | internal | 104 | 2-313(+) |
Amino Acid sequence : | |||
| RDWLVFLRNLTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQPGARVIITRNRSNLRSPS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,245.486 | ||
| Theoretical pI: | 9.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.746 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.154 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344329.1 | internal | 104 | 313-2(-) |
Amino Acid sequence : | |||
| AWRAQIGSISGDDHTSTGLFQGRGTTLPNITITTHNSHLSGNHYISSPHKSIRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSKVPQKHQPIS | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,245.486 | ||
| Theoretical pI: | 9.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 43.746 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.358 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.288 | ||
| sheet | 0.154 | ||