| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344331.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
| KGKLLLYLADLDLCTSTMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGE KPMIVVNYKGEEKQFAAEEISSMVLMKMREIAEAFLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIF EVKATA | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,440.002 | ||
| Theoretical pI: | 5.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 30.520 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.224 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344331.1 | internal | 246 | 3-740(+) |
Amino Acid sequence : | |||
| KGKLLLYLADLDLCTSTMAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVISGPGE KPMIVVNYKGEEKQFAAEEISSMVLMKMREIAEAFLGSAVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIF EVKATA | |||
Physicochemical properties | |||
| Number of amino acids: | 246 | ||
| Molecular weight: | 26,440.002 | ||
| Theoretical pI: | 5.219 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 30.520 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.224 | ||
| sheet | 0.268 | ||