| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344333.1 | complete | 142 | 111-539(+) |
Amino Acid sequence : | |||
| MSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAAFGDSSALAPGGVRIGAPAMTSRGLVEKDFEQIAEFLHRAVSLTLKIHKEHGKLLKDFNKGLVNNKEIEELKAD VEKFSASFDMPGFLVSEMKYKD* | |||
Physicochemical properties | |||
| Number of amino acids: | 142 | ||
| Molecular weight: | 15,594.806 | ||
| Theoretical pI: | 6.907 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 41.831 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.239 | ||
| sheet | 0.303 | ||