| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344338.1 | internal | 104 | 312-1(-) |
Amino Acid sequence : | |||
| YGTFQGVANHPPPPSVGFPQPVPPPGVSGDPPPPHYYAHAYQAVPGYAIAAGRPVRERRLPCCGIGLGWFMFILGFFLGAIPWSVAAFLLLCSRMVPRENPGYV | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,189.912 | ||
| Theoretical pI: | 8.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 57.552 | ||
| aromaticity | 0.144 | ||
| GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.365 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344338.1 | internal | 104 | 312-1(-) |
Amino Acid sequence : | |||
| YGTFQGVANHPPPPSVGFPQPVPPPGVSGDPPPPHYYAHAYQAVPGYAIAAGRPVRERRLPCCGIGLGWFMFILGFFLGAIPWSVAAFLLLCSRMVPRENPGYV | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,189.912 | ||
| Theoretical pI: | 8.994 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 57.552 | ||
| aromaticity | 0.144 | ||
| GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.337 | ||
| turn | 0.365 | ||
| sheet | 0.202 | ||