| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344342.1 | complete | 136 | 507-97(-) |
Amino Acid sequence : | |||
| MRSSTSMTAPIPISLCSWPSRARSMTSLKAGCFTGLVVHTLSSLERMRVELLQRCLSKKKTINGDLPGLGVFELEALQDWEYKFMSKYVKVGPVKSTVPVTDAAANGEAVKVAEGSPSEY ASKETEETATDVEKKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 13,788.435 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 68.425 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.262 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344342.1 | complete | 134 | 254-658(+) |
Amino Acid sequence : | |||
| MNLYSQSCRASSSKTPNPGRSPFIVFFFERHLCKSSTRILSSEESVWTTRPVKHPALRDVIDLALDGHEQRLIGIGAVILVELLIGDLAELNGRRRRLHLLFQLSRSMIDMGIVRTHERR ENLVEGNRHSNGCE* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 13,788.435 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 68.425 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.262 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344342.1 | 5prime_partial | 126 | 664-284(-) |
Amino Acid sequence : | |||
| AALFTAVAVAIALYQILSSLMGSNDAHVDHTSRKLEEEVKPPPPPVQLGEITDEEFNQYDGSDSNKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDDKRRSPW IGGLRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,788.435 | ||
| Theoretical pI: | 5.337 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 68.425 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.262 | ||
| sheet | 0.294 | ||