Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344342.1 | complete | 136 | 507-97(-) |
Amino Acid sequence : | |||
MRSSTSMTAPIPISLCSWPSRARSMTSLKAGCFTGLVVHTLSSLERMRVELLQRCLSKKKTINGDLPGLGVFELEALQDWEYKFMSKYVKVGPVKSTVPVTDAAANGEAVKVAEGSPSEY ASKETEETATDVEKKE* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 13,788.435 | ||
Theoretical pI: | 5.337 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 68.425 | ||
aromaticity | 0.087 | ||
GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.262 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344342.1 | complete | 134 | 254-658(+) |
Amino Acid sequence : | |||
MNLYSQSCRASSSKTPNPGRSPFIVFFFERHLCKSSTRILSSEESVWTTRPVKHPALRDVIDLALDGHEQRLIGIGAVILVELLIGDLAELNGRRRRLHLLFQLSRSMIDMGIVRTHERR ENLVEGNRHSNGCE* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 13,788.435 | ||
Theoretical pI: | 5.337 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 68.425 | ||
aromaticity | 0.087 | ||
GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.262 | ||
sheet | 0.294 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344342.1 | 5prime_partial | 126 | 664-284(-) |
Amino Acid sequence : | |||
AALFTAVAVAIALYQILSSLMGSNDAHVDHTSRKLEEEVKPPPPPVQLGEITDEEFNQYDGSDSNKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDDKRRSPW IGGLRA* | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 13,788.435 | ||
Theoretical pI: | 5.337 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 68.425 | ||
aromaticity | 0.087 | ||
GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.262 | ||
sheet | 0.294 |