Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344353.1 | 5prime_partial | 179 | 710-171(-) |
Amino Acid sequence : | |||
QKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVV LPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 13,206.298 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 88.504 | ||
aromaticity | 0.030 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.075 | ||
turn | 0.451 | ||
sheet | 0.203 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344353.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
DDFSQTSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTT TSPSWTATICRWR* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,206.298 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 88.504 | ||
aromaticity | 0.030 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.075 | ||
turn | 0.451 | ||
sheet | 0.203 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344353.1 | 5prime_partial | 179 | 710-171(-) |
Amino Acid sequence : | |||
QKKKNENKNLWAEDYPVASALRAGKSASGIILRVSKSVTATRFEETRHIRGPALSSVAAILRRFEHRARVLAAAVHLQLTGAIRHDVLRRALDGARAAVSRRRHLHRQIVAVQDGDVVVV LPPEVVEAVLRLGVRRRAEGGAVELAAAVAGEAFALAGGIKGAVGAGPDFGEFGAVLEG* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 13,206.298 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 88.504 | ||
aromaticity | 0.030 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.075 | ||
turn | 0.451 | ||
sheet | 0.203 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344353.1 | 5prime_partial | 133 | 1-402(+) |
Amino Acid sequence : | |||
DDFSQTSSPLSSLSSSSSSTPPLPSASTSKTNAPTRSGRPSSPTAAAAASTAAKPGPYPSKTAPNSPKSGPAPTAPLIPPARANASPATAAASSTAPPSARRRTPRRSTASTTSGGRTTT TSPSWTATICRWR* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,206.298 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 88.504 | ||
aromaticity | 0.030 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.075 | ||
turn | 0.451 | ||
sheet | 0.203 |