Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344360.1	5prime_partial	238	2-718(+)
Amino Acid sequence :
HAVEMEGKDGSIDKGLLQSTELYKYILDTSVYPREEECLKELRALTWTHPRAVMGTAPETGQFMALLLKTINAKKTLEIGVFTGYSLLLTALAIPHDGKITAIDINRDTYEIGLPIIEKA GVKHKIDFIESKALPALDHLLKDGENKESFDFVFVDADKVNYANYHERVLELLRPGGIVVYDNTLWGGTVAMAPDLVAESKLQYRNAAVEFNNFIAADSRVQISQLPVGDGITVCRRK*
Physicochemical properties
Number of amino acids:		238
Molecular weight:		14,885.172
Theoretical pI:		9.590
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		30.991
aromaticity		0.102
GRAVY		-0.103
Secondary Structure Fraction
Helix		0.362
turn		0.213
sheet		0.197

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344360.1	5prime_partial	127	802-419(-)
Amino Acid sequence :
EFSSQFPYKTMLYVRKEGNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLHCSIPVLELALRHQIRRHRNGASPQCVVINNYSTWPQKLQHPFMVVCIVHFISIHKHEVKTL FILPIFE*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,885.172
Theoretical pI:		9.590
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11710
Instability index:		30.991
aromaticity		0.102
GRAVY		-0.103
Secondary Structure Fraction
Helix		0.362
turn		0.213
sheet		0.197