| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344362.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| SPFLLLLQFIPSEMATLIPPPPAASNSAAEPQKVDYLNLPCPIPYEEIHREALMSLKPELFEGLRFDFTKGLNQKFSLSHSVTMGPTEIPAQSSDVIKIPTANYEFGANFIDPKLMLFGR VTTDGRLNARLKCDLTDNLSLKGNAQLTNEPHMSHGMFNFDYKGSDFRTQFQVGNGALFGASYIQSVTPNLSLGGEVFWAGQHRKSGIGYAARYNTDKMVATGQVASTGIVALGYVQKVS EKVSLATDFMFNY | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,801.383 | ||
| Theoretical pI: | 6.201 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 22.716 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.281 | ||
| sheet | 0.261 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344362.1 | internal | 253 | 3-761(+) |
Amino Acid sequence : | |||
| SPFLLLLQFIPSEMATLIPPPPAASNSAAEPQKVDYLNLPCPIPYEEIHREALMSLKPELFEGLRFDFTKGLNQKFSLSHSVTMGPTEIPAQSSDVIKIPTANYEFGANFIDPKLMLFGR VTTDGRLNARLKCDLTDNLSLKGNAQLTNEPHMSHGMFNFDYKGSDFRTQFQVGNGALFGASYIQSVTPNLSLGGEVFWAGQHRKSGIGYAARYNTDKMVATGQVASTGIVALGYVQKVS EKVSLATDFMFNY | |||
Physicochemical properties | |||
| Number of amino acids: | 253 | ||
| Molecular weight: | 27,801.383 | ||
| Theoretical pI: | 6.201 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
| Instability index: | 22.716 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.281 | ||
| sheet | 0.261 | ||