| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344368.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| GCIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLI STQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVP EPLSVFVDTYKTGTI | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 27,302.763 | ||
| Theoretical pI: | 6.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 27.199 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.231 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.239 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344368.1 | internal | 255 | 2-766(+) |
Amino Acid sequence : | |||
| GCIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLI STQHDETVTNDQIAQDLKEHVIKPVIPAKYLDDKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSVVASGLARRCIVQVSYAIGVP EPLSVFVDTYKTGTI | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 27,302.763 | ||
| Theoretical pI: | 6.859 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 27.199 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.231 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.239 | ||
| sheet | 0.184 | ||