| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344380.1 | 3prime_partial | 217 | 80-730(+) |
Amino Acid sequence : | |||
| METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKP | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 22,479.614 | ||
| Theoretical pI: | 6.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.551 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.250 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344380.1 | 5prime_partial | 212 | 730-92(-) |
Amino Acid sequence : | |||
| GLDHVLLEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALL LNIHQNLAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLVGVALIHRLRCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 22,479.614 | ||
| Theoretical pI: | 6.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.551 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.250 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344380.1 | 3prime_partial | 217 | 80-730(+) |
Amino Acid sequence : | |||
| METFLFTSESVNEGHPDKLCDQVSDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCAWLRPDGKTQVTVEYYNDNGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKP | |||
Physicochemical properties | |||
| Number of amino acids: | 217 | ||
| Molecular weight: | 22,479.614 | ||
| Theoretical pI: | 6.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.551 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.250 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344380.1 | 5prime_partial | 212 | 730-92(-) |
Amino Acid sequence : | |||
| GLDHVLLEIGSNFVVSDSLVVLCGDQHGVDTDGNHGAVVIVVLNSDLGLAIRPQPRAGAVFPDLSETGTELGGKNMAQRHQLGGLVRGIAKHVTLVTSTDFFRSFGEVAVNTLSNIRALL LNIHQNLAIISIKAYIIRNKSNGTASVTDNLLVVDISLGCNLSEHHDHVSLGACLTGNLAVRVLSETGIKHRIGDLIAQLVGVALIHRLRCK* | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 22,479.614 | ||
| Theoretical pI: | 6.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 19.551 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.250 | ||
| sheet | 0.245 | ||