Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344390.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
DASKRMKEFIRGPKFGYIVASILILNFVAVVIETTLDIQNSSAQDAWQKVEFIFGWLYVLEVILKVYAYGFVNYWRDGQNRFDFVITWVIVIGETATFLSPSGQTFLSNGEWIRYLLIAR MLRLIRLLMHVKQYRAFVATFLTLIPSLMPYLGTIFCVLCIYCSLGVQLFGGMVNAGNPILSTTDIQDSDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKDLTGSAWCYIYFISFYL ITVLLLLN | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 28,646.364 | ||
Theoretical pI: | 6.763 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66600 | ||
Instability index: | 25.599 | ||
aromaticity | 0.169 | ||
GRAVY | 0.569 | ||
Secondary Structure Fraction | |||
Helix | 0.476 | ||
turn | 0.198 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344390.1 | internal | 248 | 2-745(+) |
Amino Acid sequence : | |||
DASKRMKEFIRGPKFGYIVASILILNFVAVVIETTLDIQNSSAQDAWQKVEFIFGWLYVLEVILKVYAYGFVNYWRDGQNRFDFVITWVIVIGETATFLSPSGQTFLSNGEWIRYLLIAR MLRLIRLLMHVKQYRAFVATFLTLIPSLMPYLGTIFCVLCIYCSLGVQLFGGMVNAGNPILSTTDIQDSDYLLFNFNDYPNGMVTLFNLLVMGNWQLWMQSYKDLTGSAWCYIYFISFYL ITVLLLLN | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 28,646.364 | ||
Theoretical pI: | 6.763 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66600 | ||
Instability index: | 25.599 | ||
aromaticity | 0.169 | ||
GRAVY | 0.569 | ||
Secondary Structure Fraction | |||
Helix | 0.476 | ||
turn | 0.198 | ||
sheet | 0.242 |