| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344392.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
| TPITMTTFMPPPPAAPFLAFHPQDNNIIAIGMDDSTIQIYNVRIDEVKSKLKGHTKRITGLAFSNVLNVLVSSGADAQICVWSSDGWEKQKSRFLQLPPGRSPAAQSETRVQFHQDQIHF LVVHETQLAIYETTKLDCVKQWAPRESAAPISHATFSCDSQLVYASFLDGTVCIFTAAHLRLRCRINPSAYLPSSVSSSNVHPLVIAAHPHEPNQFALGLSDGSVHVFEPLESEGKWGVP PPAENGSASSVPTTPLVGGSGQDQAQR | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 28,987.421 | ||
| Theoretical pI: | 6.231 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 47.822 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.172 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.281 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344392.1 | internal | 267 | 3-803(+) |
Amino Acid sequence : | |||
| TPITMTTFMPPPPAAPFLAFHPQDNNIIAIGMDDSTIQIYNVRIDEVKSKLKGHTKRITGLAFSNVLNVLVSSGADAQICVWSSDGWEKQKSRFLQLPPGRSPAAQSETRVQFHQDQIHF LVVHETQLAIYETTKLDCVKQWAPRESAAPISHATFSCDSQLVYASFLDGTVCIFTAAHLRLRCRINPSAYLPSSVSSSNVHPLVIAAHPHEPNQFALGLSDGSVHVFEPLESEGKWGVP PPAENGSASSVPTTPLVGGSGQDQAQR | |||
Physicochemical properties | |||
| Number of amino acids: | 267 | ||
| Molecular weight: | 28,987.421 | ||
| Theoretical pI: | 6.231 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28210 | ||
| Instability index: | 47.822 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.172 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.281 | ||
| sheet | 0.217 | ||