| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344404.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
| EEEDGSMHIVGMHAHAAHHRHSHSQEHGACEGHRLEDGHGHSHSHSLSFGSGDGDDSVRHTVVSQVLELGIVSHSAIIGLSLGVSHSPCTIRPLIGALSFHQFFEGFALGGCISQAKLRS LQSTLMACFFALTTPLGIGIGIGISSFYNASSPRAIVTEGISNSDICL | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 17,683.585 | ||
| Theoretical pI: | 6.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 51.423 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.310 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344404.1 | internal | 168 | 1-504(+) |
Amino Acid sequence : | |||
| EEEDGSMHIVGMHAHAAHHRHSHSQEHGACEGHRLEDGHGHSHSHSLSFGSGDGDDSVRHTVVSQVLELGIVSHSAIIGLSLGVSHSPCTIRPLIGALSFHQFFEGFALGGCISQAKLRS LQSTLMACFFALTTPLGIGIGIGISSFYNASSPRAIVTEGISNSDICL | |||
Physicochemical properties | |||
| Number of amino acids: | 168 | ||
| Molecular weight: | 17,683.585 | ||
| Theoretical pI: | 6.057 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 51.423 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.274 | ||
| turn | 0.310 | ||
| sheet | 0.232 | ||