| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344407.1 | internal | 158 | 1-474(+) |
Amino Acid sequence : | |||
| WKFTGFISLFELLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPH RLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAP | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 18,574.169 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48470 48845 | ||
| Instability index: | 55.513 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.222 | ||
| sheet | 0.184 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344407.1 | internal | 158 | 1-474(+) |
Amino Acid sequence : | |||
| WKFTGFISLFELLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPH RLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAP | |||
Physicochemical properties | |||
| Number of amino acids: | 158 | ||
| Molecular weight: | 18,574.169 | ||
| Theoretical pI: | 8.959 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48470 48845 | ||
| Instability index: | 55.513 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.222 | ||
| sheet | 0.184 | ||