Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344409.1 | internal | 216 | 2-649(+) |
Amino Acid sequence : | |||
LKALQGFPLKTISTKGMLAVYNALDEQGKKEFETAYSASFYPCMDILYECYEDVASGSEIRSVVLAGRRFYEKEGLPAFPMGKIDQTRMWKVGERVRSKRPAGDLGPLYPFTAGVFVALM MAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDNATPINHDLISNFLSDPCPRGHR | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 24,198.572 | ||
Theoretical pI: | 8.331 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
Instability index: | 46.401 | ||
aromaticity | 0.102 | ||
GRAVY | -0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.236 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344409.1 | internal | 216 | 2-649(+) |
Amino Acid sequence : | |||
LKALQGFPLKTISTKGMLAVYNALDEQGKKEFETAYSASFYPCMDILYECYEDVASGSEIRSVVLAGRRFYEKEGLPAFPMGKIDQTRMWKVGERVRSKRPAGDLGPLYPFTAGVFVALM MAQIEILRKKGHSYSEIINESVIESVDSLNPFMHARGVSFMVDNCSTTARLGSRKWAPRFDYILTQQALVAVDNATPINHDLISNFLSDPCPRGHR | |||
Physicochemical properties | |||
Number of amino acids: | 216 | ||
Molecular weight: | 24,198.572 | ||
Theoretical pI: | 8.331 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24660 | ||
Instability index: | 46.401 | ||
aromaticity | 0.102 | ||
GRAVY | -0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.236 | ||
sheet | 0.264 |