| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344416.1 | internal | 123 | 371-3(-) |
Amino Acid sequence : | |||
| KSFTQEAIDWIKNEPNFAVKAGLIGRCWDDIGSHKRESKGGEMLPAMDCYMEQSRVSIQERISEFAKAVEDLWKEVTEGWVYTISMSKEITVQFLKYFRMGDESSYRNNGDGYTDPSFAK SNI | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,151.738 | ||
| Theoretical pI: | 5.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 47.105 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.630 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.236 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344416.1 | internal | 123 | 371-3(-) |
Amino Acid sequence : | |||
| KSFTQEAIDWIKNEPNFAVKAGLIGRCWDDIGSHKRESKGGEMLPAMDCYMEQSRVSIQERISEFAKAVEDLWKEVTEGWVYTISMSKEITVQFLKYFRMGDESSYRNNGDGYTDPSFAK SNI | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,151.738 | ||
| Theoretical pI: | 5.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29575 | ||
| Instability index: | 47.105 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.630 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.236 | ||
| sheet | 0.228 | ||