| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344441.1 | complete | 132 | 89-487(+) |
Amino Acid sequence : | |||
| MAKVFTLAEVSEHSTNKDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVGHSENAKSMMEEWCIGEIDVSTIPSKKKYTPPKQPHYNQDKTSEFIIKLLQFLVPLIILGV AVGLRFYSKSEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,724.588 | ||
| Theoretical pI: | 4.993 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 39.383 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.261 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.220 | ||
| sheet | 0.227 | ||