Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344453.1	5prime_partial	195	2-589(+)
Amino Acid sequence :
VEICLRGNTLFSGYYKRQDLTDEVLVDGWFHTGDIGEWQPNGAMKIIDRKKNIFKLSQGEYVAVESLESTFSRCPIITSIWVYGNSFESFLVAVVVPERKALEDWAASNQEKGDFPTLCK NTNARKYVLDELNSTAKKHNLRGFEMLRAVHLEPVPFDIGRDLVTPTFKLKRPQLLKHYKDCIDKLYSEAKGTKP*
Physicochemical properties
Number of amino acids:		195
Molecular weight:		12,946.116
Theoretical pI:		9.382
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16750
Instability index:		45.011
aromaticity		0.127
GRAVY		0.141
Secondary Structure Fraction
Helix		0.382
turn		0.209
sheet		0.218

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344453.1	complete	110	598-266(-)
Amino Acid sequence :
MEFLWFCSFSFTVQLINTILVMLQQLRPLKLESWSNQISTDVKRNWLQMNSPQHFKTSKIMFLCSAVELIKNVFSGVRVFTQSGEVPLFLIAGCPIFECFSLRHHHRHQK*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,946.116
Theoretical pI:		9.382
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16750
Instability index:		45.011
aromaticity		0.127
GRAVY		0.141
Secondary Structure Fraction
Helix		0.382
turn		0.209
sheet		0.218