| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344463.1 | 5prime_partial | 177 | 626-93(-) |
Amino Acid sequence : | |||
| VSQVAKKTLTKGVNGEFPPSRFWEKDFLRLVDREYVFVYIEDPCRAPFPFMQKLRQVLVEHPLNNGEKEKNVSSSFFQKIQVFEEELKAVLPKEMEAGKTAMVGGNPAVANRIKECRSYP LSKFLREELGTEFLTGGKTTSPGEEGDKVFPALSNGLIVDPLLKSLEAWNGEPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,906.693 | ||
| Theoretical pI: | 6.028 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 36.903 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.254 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344463.1 | 5prime_partial | 177 | 626-93(-) |
Amino Acid sequence : | |||
| VSQVAKKTLTKGVNGEFPPSRFWEKDFLRLVDREYVFVYIEDPCRAPFPFMQKLRQVLVEHPLNNGEKEKNVSSSFFQKIQVFEEELKAVLPKEMEAGKTAMVGGNPAVANRIKECRSYP LSKFLREELGTEFLTGGKTTSPGEEGDKVFPALSNGLIVDPLLKSLEAWNGEPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,906.693 | ||
| Theoretical pI: | 6.028 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 36.903 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.254 | ||
| sheet | 0.282 | ||