| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344468.1 | 5prime_partial | 166 | 1-501(+) |
Amino Acid sequence : | |||
| IDFHQTLEVNGIRFWCYTAGHVLGAAMFMVDIAGVRVLYTGDYSREEDRHLRAAELPQFSPDVCIIESTYGVQNHQPRHIREKLFTEVIHATISRGGRVLIPAFALGRAQELLLILDEYW ESHRDLHNVPIYYASPLAKRCMAVYQTYINSMNDRIRNQFASSNPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 19,109.579 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 41.751 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.193 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344468.1 | 5prime_partial | 166 | 1-501(+) |
Amino Acid sequence : | |||
| IDFHQTLEVNGIRFWCYTAGHVLGAAMFMVDIAGVRVLYTGDYSREEDRHLRAAELPQFSPDVCIIESTYGVQNHQPRHIREKLFTEVIHATISRGGRVLIPAFALGRAQELLLILDEYW ESHRDLHNVPIYYASPLAKRCMAVYQTYINSMNDRIRNQFASSNPL* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 19,109.579 | ||
| Theoretical pI: | 6.466 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24535 | ||
| Instability index: | 41.751 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.343 | ||
| turn | 0.193 | ||
| sheet | 0.259 | ||