| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344470.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| WYPVATVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGVGACKFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKY KDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDVNGFSAKHV | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 24,030.045 | ||
| Theoretical pI: | 6.320 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58900 59400 | ||
| Instability index: | 40.499 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.233 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344470.1 | internal | 210 | 3-632(+) |
Amino Acid sequence : | |||
| WYPVATVCDLDKRRPHGRKVIGIDVVVWWDRKENAWKVFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGVGACKFIPQAPHDGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKY KDIYLTNKPHYIPELDDPSFTCTTITREVPYGYEILAENLMDPSHVPYAHYGILELEKVKESSKRDREGGHEMEISVGTIDVNGFSAKHV | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 24,030.045 | ||
| Theoretical pI: | 6.320 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58900 59400 | ||
| Instability index: | 40.499 | ||
| aromaticity | 0.114 | ||
| GRAVY | -0.500 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.233 | ||
| sheet | 0.162 | ||