| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344472.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| ISHTFKQNSTHRSTVAKMPSVHGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNSHLRELEGAAERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPAVEGA KSVIRAAAEAKVRRVVLTSSIGAVYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWETAKELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGSAKTYANSIXAYVD VKD | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 26,387.840 | ||
| Theoretical pI: | 6.345 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
| Instability index: | 26.377 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.215 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344472.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| ISHTFKQNSTHRSTVAKMPSVHGKVVCVTGAGGFIASWLVKLLLEKGYTVRGTVRNPDDPKNSHLRELEGAAERLILCRADLNVYESLREAINGCDGVFHTASPVTDDPEQMVEPAVEGA KSVIRAAAEAKVRRVVLTSSIGAVYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWETAKELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGSAKTYANSIXAYVD VKD | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 26,387.840 | ||
| Theoretical pI: | 6.345 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33920 34295 | ||
| Instability index: | 26.377 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.215 | ||
| sheet | 0.264 | ||