Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344473.1 | 5prime_partial | 220 | 791-129(-) |
Amino Acid sequence : | |||
AKVRRVVLTSSIGAVYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWETAKELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGSAKTYANSIQAYVDVKDVALAHI LLFENPAASGRYLCAESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKKPYKFSNQKLKDLGLEFTPVRQSLYDTVKSLQEKGHLPIPTQNEDPVRIHP* | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 24,659.079 | ||
Theoretical pI: | 7.792 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31650 | ||
Instability index: | 31.139 | ||
aromaticity | 0.086 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.214 | ||
sheet | 0.255 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344473.1 | 5prime_partial | 220 | 791-129(-) |
Amino Acid sequence : | |||
AKVRRVVLTSSIGAVYMDPNRDPDKVVDETCWSDLEFCKNTKNWYCYGKAVAEQAAWETAKELGVDLVVLNPVLVLGSLLQPTVNASVLHILKYLTGSAKTYANSIQAYVDVKDVALAHI LLFENPAASGRYLCAESVLHRGEVVEILAKFFPEYPIPTKCSDEKNPRKKPYKFSNQKLKDLGLEFTPVRQSLYDTVKSLQEKGHLPIPTQNEDPVRIHP* | |||
Physicochemical properties | |||
Number of amino acids: | 220 | ||
Molecular weight: | 24,659.079 | ||
Theoretical pI: | 7.792 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31650 | ||
Instability index: | 31.139 | ||
aromaticity | 0.086 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.214 | ||
sheet | 0.255 |