| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344482.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| ARRSFALPFWNWDNPNGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQLVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTSIHIFVGDTRQPRNEN MGNFYSAGRDPLFYCHHANVDRMWTVWQKLPSTVIPKKTIDDPDFLNATFLLYDENGKLVRVSVKDTIDNRKMGYDFERIDLPWQDYRPPRQTAKAKINRASAPKPPKARSLFP | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 10,819.098 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 87.697 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.070 | ||
| turn | 0.370 | ||
| sheet | 0.130 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344482.1 | complete | 100 | 353-655(+) |
Amino Acid sequence : | |||
| MRTWATSTPRGGTRFSTATTPTSTACGRSGRSSRQPSSRRKRSTIPISLMPPSSSTMRMASSSASPSKTPSTTAKWGTTSRGSTCRGRTTARHGRLRRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,819.098 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 87.697 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.070 | ||
| turn | 0.370 | ||
| sheet | 0.130 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344482.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| ARRSFALPFWNWDNPNGMTIPPMFNIVGSPIYDEKREPTHLTSIVDLGRTGSTDPLQLVANNLTIMYSEMVRGNNDVFDFMGQPYRLGTPVSPGAGASERGSHTSIHIFVGDTRQPRNEN MGNFYSAGRDPLFYCHHANVDRMWTVWQKLPSTVIPKKTIDDPDFLNATFLLYDENGKLVRVSVKDTIDNRKMGYDFERIDLPWQDYRPPRQTAKAKINRASAPKPPKARSLFP | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 10,819.098 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 87.697 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.070 | ||
| turn | 0.370 | ||
| sheet | 0.130 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344482.1 | complete | 100 | 353-655(+) |
Amino Acid sequence : | |||
| MRTWATSTPRGGTRFSTATTPTSTACGRSGRSSRQPSSRRKRSTIPISLMPPSSSTMRMASSSASPSKTPSTTAKWGTTSRGSTCRGRTTARHGRLRRRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,819.098 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 87.697 | ||
| aromaticity | 0.030 | ||
| GRAVY | -1.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.070 | ||
| turn | 0.370 | ||
| sheet | 0.130 | ||