| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344488.1 | 3prime_partial | 203 | 30-638(+) |
Amino Acid sequence : | |||
| MDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWD DIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKPVEDSWKEANEGWVYTISMSKEITVQFLNYSSNVRCELQPEQWRR | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 23,961.145 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 42.565 | ||
| aromaticity | 0.133 | ||
| GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.202 | ||
| sheet | 0.246 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344488.1 | 3prime_partial | 203 | 30-638(+) |
Amino Acid sequence : | |||
| MDEIDRLPDYMKIVLHFVMSAYEEYERDAKKNGKKFASPYFKETIQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMFASIIPGLKSFTQEAIDWIKNEPNFAVKAGLIGRYWD DIGSHKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKPVEDSWKEANEGWVYTISMSKEITVQFLNYSSNVRCELQPEQWRR | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 23,961.145 | ||
| Theoretical pI: | 5.595 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51005 | ||
| Instability index: | 42.565 | ||
| aromaticity | 0.133 | ||
| GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.202 | ||
| sheet | 0.246 | ||