| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344490.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| DNQYQNYAKFSPTMAIIVVVLIAVLFLMGFFSIYIRHCSDASAGGSVRRALSLRRRGGAAPGLDDAVLETFPTFTYSEVKDHKIGKGALECAVCLNEFEDDETLRLIPRCDHVFHPQCID TWLQSHVTCPVCRTNLIPEPGEVTLPVQLQTESVDSENDTLERSRSRNVEIAVQINEPDNQQPGRSSSFAYPN | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,517.026 | ||
| Theoretical pI: | 5.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 60.119 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.238 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344490.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| DNQYQNYAKFSPTMAIIVVVLIAVLFLMGFFSIYIRHCSDASAGGSVRRALSLRRRGGAAPGLDDAVLETFPTFTYSEVKDHKIGKGALECAVCLNEFEDDETLRLIPRCDHVFHPQCID TWLQSHVTCPVCRTNLIPEPGEVTLPVQLQTESVDSENDTLERSRSRNVEIAVQINEPDNQQPGRSSSFAYPN | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,517.026 | ||
| Theoretical pI: | 5.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 60.119 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.225 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.238 | ||
| sheet | 0.228 | ||