Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344491.1 | 5prime_partial | 124 | 3-377(+) |
Amino Acid sequence : | |||
FTLISSPHSQLMAPFLQASLLFFFLLVSTLALEAVAARDIPTDARMQPEMSFDGTVWVPGLGRYYIPRKGTKSLDYNPITGSPGGNGVSIPGITGSAGTHTTIPGGDDTTLPNPIGGAVP SPHP* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 11,172.950 | ||
Theoretical pI: | 9.925 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 68.350 | ||
aromaticity | 0.078 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.301 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344491.1 | complete | 103 | 160-471(+) |
Amino Acid sequence : | |||
MARSGSRASAVTTSLERAQSLWTTTPSPVPPVATACPFLGSLARLAPTPPFPAEMTPRCPTLSVEPFPHRTLELRLRGQWWGNLCFLLGGMQARSCCFKSSLL* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,172.950 | ||
Theoretical pI: | 9.925 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 68.350 | ||
aromaticity | 0.078 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.301 |