Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344493.1	complete	145	66-503(+)
Amino Acid sequence :
MSSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGVKSKEILIWITICDISIKDPESGK ITFGTPTGISRAFPVSAFEEEEEKK*
Physicochemical properties
Number of amino acids:		145
Molecular weight:		16,394.608
Theoretical pI:		6.840
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21095
Instability index:		56.149
aromaticity		0.083
GRAVY		-0.422
Secondary Structure Fraction
Helix		0.297
turn		0.207
sheet		0.228