Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344498.1	5prime_partial	168	612-106(-)
Amino Acid sequence :
SSSPCPSGGPPGTNHFQLKVLRAYWAFMRLTLLQPEPNNIMLILAFTTRTSHYSFVIIRPDHSRFFLRSEWTNGVVNFQNVPSFKLGLELFTLVTSSNRHYILHSFRHIPGLRREETGED RERTADILRSSGRSNGDLRCLGRSGRGESAELDSEPSEHDSDPIKLSD*
Physicochemical properties
Number of amino acids:		168
Molecular weight:		11,365.933
Theoretical pI:		10.708
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		112.246
aromaticity		0.039
GRAVY		-0.485
Secondary Structure Fraction
Helix		0.243
turn		0.398
sheet		0.243

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344498.1	complete	152	136-594(+)
Amino Acid sequence :
MFRRLAIQLRTLAPTRSAKAAQVAVGSSRASENVRRSLPVFSRLFSTESGNVPKRVEDIMPIATGHEREELEAELEGRDILEINNPVGPFGTKEEPAVIRSYYDKRIVGCPGGEGEDEHD VVWFWLEKGKPHECPVCSQNFELEVVGPWRTS*
Physicochemical properties
Number of amino acids:		152
Molecular weight:		11,365.933
Theoretical pI:		10.708
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		112.246
aromaticity		0.039
GRAVY		-0.485
Secondary Structure Fraction
Helix		0.243
turn		0.398
sheet		0.243

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344498.1	5prime_partial	103	2-313(+)
Amino Acid sequence :
PNQRLFTLPPPSLPPFSLSTPTSIFLQRHKKPAVDQSESLIGSESCSEGSLSSSALSPRPDLPRQRRSPLDLPELRRMSAVLSLSSPVSSRRSPGMCLKEWRI*
Physicochemical properties
Number of amino acids:		103
Molecular weight:		11,365.933
Theoretical pI:		10.708
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		112.246
aromaticity		0.039
GRAVY		-0.485
Secondary Structure Fraction
Helix		0.243
turn		0.398
sheet		0.243