Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344499.1	complete	175	263-790(+)
Amino Acid sequence :
MFSDDDIVIISMSIRRSARTNHFQLKVLRAYWAFMRLTLLQPEPNNIMLILAFTTRTSHYSFVIIRPDHSRFFLRSEWTNGVVNFQNVPSFKLGLELFTLVTSSNRHYILHSFRHIPGLR REETGEDRERTADILRSSGRSNGDLRCLGRSGRGESAELDNEPSEHDSDPIKLSD*
Physicochemical properties
Number of amino acids:		175
Molecular weight:		18,406.422
Theoretical pI:		4.910
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		60.119
aromaticity		0.066
GRAVY		-0.480
Secondary Structure Fraction
Helix		0.277
turn		0.259
sheet		0.253

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY344499.1	complete	166	760-260(-)
Amino Acid sequence :
MFRRLVIQLRTLAPTRSAKAAQVAVGSSRASENVRRSLPVFSRLFSTESGNVPKRVEDIMPIATGHEREELEAELEGRDILEINNPVGPFGTKEEPAVIRSYYDKRIVGCPGGEGEDEHD VVWFWLEKGKPHECPVCSQYFELEVVGPGGPPDGHGDDDDIIIAEH*
Physicochemical properties
Number of amino acids:		166
Molecular weight:		18,406.422
Theoretical pI:		4.910
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15595
Instability index:		60.119
aromaticity		0.066
GRAVY		-0.480
Secondary Structure Fraction
Helix		0.277
turn		0.259
sheet		0.253