| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344501.1 | internal | 215 | 1-645(+) |
Amino Acid sequence : | |||
| VPFKSRTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYRAAQIFSDPKVAAEVPWYGIEQEYTLLQSNVNWPLGWPVGGYPG PQGPYYCGAGAEKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLSLDPKPIQGDWNGAG | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 12,356.391 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.134 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344501.1 | 5prime_partial | 113 | 645-304(-) |
Amino Acid sequence : | |||
| SCTIPVALYWFWIKREHNSSLLCNSLEEVPRAPDVVSGFDSNTRTNLKLPLARHNLPICTTNIDPSIQASFVMSIGYIAPERFLRSSPAVVRTLRARVTSNRPTKRPVYIALK* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,356.391 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.134 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344501.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
| FLLNQGPYRSRLSIHLSSLNGTMMDQAQDRHLEKTVKSFYILKPFSRTLFGVAITSWLYAIRTLRQASLFRRTNDTELLRFSVTPRLLLKFHGMALSKSIPYFKAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,356.391 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.134 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344501.1 | internal | 215 | 1-645(+) |
Amino Acid sequence : | |||
| VPFKSRTISKPVEHPSELPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRGGNNILVICDTYTPAGEPIPTNKRYRAAQIFSDPKVAAEVPWYGIEQEYTLLQSNVNWPLGWPVGGYPG PQGPYYCGAGAEKSFGRDISDAHYKACLYAGINISGTNGEVMPGQWEFQVGPSVGIEAGDHIWCARYLLERITEQAGVVLSLDPKPIQGDWNGAG | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 12,356.391 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.134 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344501.1 | 5prime_partial | 113 | 645-304(-) |
Amino Acid sequence : | |||
| SCTIPVALYWFWIKREHNSSLLCNSLEEVPRAPDVVSGFDSNTRTNLKLPLARHNLPICTTNIDPSIQASFVMSIGYIAPERFLRSSPAVVRTLRARVTSNRPTKRPVYIALK* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,356.391 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.134 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344501.1 | 5prime_partial | 106 | 2-322(+) |
Amino Acid sequence : | |||
| FLLNQGPYRSRLSIHLSSLNGTMMDQAQDRHLEKTVKSFYILKPFSRTLFGVAITSWLYAIRTLRQASLFRRTNDTELLRFSVTPRLLLKFHGMALSKSIPYFKAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,356.391 | ||
| Theoretical pI: | 11.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 33.134 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.208 | ||
| sheet | 0.274 | ||