Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344503.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
KLIICGGSPYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVA LKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLVEKDFQQIA | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 24,479.972 | ||
Theoretical pI: | 9.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 42.165 | ||
aromaticity | 0.084 | ||
GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.247 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344503.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
KLIICGGSPYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVA LKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLVEKDFQQIA | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 24,479.972 | ||
Theoretical pI: | 9.075 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
Instability index: | 42.165 | ||
aromaticity | 0.084 | ||
GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.247 | ||
sheet | 0.260 |