| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344503.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| KLIICGGSPYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVA LKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLVEKDFQQIA | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,479.972 | ||
| Theoretical pI: | 9.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
| Instability index: | 42.165 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.247 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344503.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| KLIICGGSPYPRDWDYKRFRQVADKCGALLLCDMAHISGLVAAQEAADPFEYCDLVTTTTHKSLRGPRAGMIFYRKGPKPPKKGQPEDAVYDFEDKINFAVFPSLQGGPHNHQIGALAVA LKQALSPGFKAYAKQVKANAVALGNYLMSKGYSLVTGGTENHLVLWDLRPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLVEKDFQQIA | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 24,479.972 | ||
| Theoretical pI: | 9.075 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23295 | ||
| Instability index: | 42.165 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.247 | ||
| sheet | 0.260 | ||