| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344513.1 | 3prime_partial | 209 | 67-693(+) |
Amino Acid sequence : | |||
| MESRRSAHLGASIWDDNFIQSLASPYAGEKYAEKAEKLKTEVKTMIDQTRDELEQLELIDNLQRLGICHHFEDLIKKILHKIYGEESNGDHQHYREKGLHFTALRFRLLRQDGYHVPQDV FDCFMNKAGNFEEYLSIDITGLISLYEASYLSTEGETILDLAKDFSSHHLHKMVVETTEKRVVEQIIHALEMPLHRRVQRLEARWFIQF | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 24,573.589 | ||
| Theoretical pI: | 5.794 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 51.448 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.144 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344513.1 | 3prime_partial | 209 | 67-693(+) |
Amino Acid sequence : | |||
| MESRRSAHLGASIWDDNFIQSLASPYAGEKYAEKAEKLKTEVKTMIDQTRDELEQLELIDNLQRLGICHHFEDLIKKILHKIYGEESNGDHQHYREKGLHFTALRFRLLRQDGYHVPQDV FDCFMNKAGNFEEYLSIDITGLISLYEASYLSTEGETILDLAKDFSSHHLHKMVVETTEKRVVEQIIHALEMPLHRRVQRLEARWFIQF | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 24,573.589 | ||
| Theoretical pI: | 5.794 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 51.448 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.509 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.144 | ||
| sheet | 0.301 | ||