Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344527.1 | complete | 99 | 304-603(+) |
Amino Acid sequence : | |||
MGQSVELLINEEEELVDYKYYRGLIGSLLYLTASRPDISYAVGVCARFQAKPRKSHLEAAKRIVSYLKNSTSMGLWYPHDDGLDLIGYSDADYTGCKVD* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,143.497 | ||
Theoretical pI: | 5.287 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 19035 | ||
Instability index: | 23.929 | ||
aromaticity | 0.111 | ||
GRAVY | -0.280 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.222 | ||
sheet | 0.273 |