| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344535.1 | 5prime_partial | 237 | 3-716(+) |
Amino Acid sequence : | |||
| FSMMADDKVVASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVAAGTENGKRAKEFMEKGQLVPDEIVVMMVKERLSQQDSLENGWLLDGYPRSESQATALKKLGF DPDIFILLEVPEDILVERVVGRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLVTHNSNVEAVLSLYEDLICKVDGTLPKEEVFTQIDTTLSELLTKKEAALGSLAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,130.720 | ||
| Theoretical pI: | 4.974 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 37.787 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.177 | ||
| sheet | 0.338 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344535.1 | 5prime_partial | 237 | 3-716(+) |
Amino Acid sequence : | |||
| FSMMADDKVVASAGKAEPLRVMISGAPASGKGTQCELITKKYDLVHIAAGDLLRAEVAAGTENGKRAKEFMEKGQLVPDEIVVMMVKERLSQQDSLENGWLLDGYPRSESQATALKKLGF DPDIFILLEVPEDILVERVVGRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLVTHNSNVEAVLSLYEDLICKVDGTLPKEEVFTQIDTTLSELLTKKEAALGSLAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,130.720 | ||
| Theoretical pI: | 4.974 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 37.787 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.197 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.177 | ||
| sheet | 0.338 | ||