| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344541.1 | complete | 152 | 86-544(+) |
Amino Acid sequence : | |||
| MSTPARKRLMRDFKRLQQDPPAGITGAPQENNIMLWNAVIFGPDDTPWDGGTFKLTLQFAKDDPNKPPTVPFVTRMFHPNIYADGSICLDILQNQRSPIYDVAAILTSIQSLLCDPNPNS PANSEAARMFSENKREYNLRWREIVEQSWTAD* | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 12,223.026 | ||
| Theoretical pI: | 6.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 78.180 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.264 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344541.1 | complete | 108 | 270-596(+) |
Amino Acid sequence : | |||
| MIQTSHPQFHLLLECSIQIFMRMEVFVWTFFKIRGALYMMLQPYSHLSSRCCVIRIQILRQIRKLLGCSARTRENTISDGGRLWNRVGPLIKRIGNSNSITELVVRFT* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,223.026 | ||
| Theoretical pI: | 6.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 78.180 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.264 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344541.1 | 3prime_partial | 106 | 319-2(-) |
Amino Acid sequence : | |||
| MEHSSNKWNCGWLVWIIFCELKSQLERASIPWCIIRAKYNSIPKHNIVLLRSSSDASRWILLQPLEIPHQSLSSRSGHIIALLSEVLMEQMDGARVEKREPSGEIE | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,223.026 | ||
| Theoretical pI: | 6.902 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
| Instability index: | 78.180 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.264 | ||
| sheet | 0.283 | ||