Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344541.1 | complete | 152 | 86-544(+) |
Amino Acid sequence : | |||
MSTPARKRLMRDFKRLQQDPPAGITGAPQENNIMLWNAVIFGPDDTPWDGGTFKLTLQFAKDDPNKPPTVPFVTRMFHPNIYADGSICLDILQNQRSPIYDVAAILTSIQSLLCDPNPNS PANSEAARMFSENKREYNLRWREIVEQSWTAD* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 12,223.026 | ||
Theoretical pI: | 6.902 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 78.180 | ||
aromaticity | 0.066 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.264 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344541.1 | complete | 108 | 270-596(+) |
Amino Acid sequence : | |||
MIQTSHPQFHLLLECSIQIFMRMEVFVWTFFKIRGALYMMLQPYSHLSSRCCVIRIQILRQIRKLLGCSARTRENTISDGGRLWNRVGPLIKRIGNSNSITELVVRFT* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 12,223.026 | ||
Theoretical pI: | 6.902 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 78.180 | ||
aromaticity | 0.066 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.264 | ||
sheet | 0.283 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344541.1 | 3prime_partial | 106 | 319-2(-) |
Amino Acid sequence : | |||
MEHSSNKWNCGWLVWIIFCELKSQLERASIPWCIIRAKYNSIPKHNIVLLRSSSDASRWILLQPLEIPHQSLSSRSGHIIALLSEVLMEQMDGARVEKREPSGEIE | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,223.026 | ||
Theoretical pI: | 6.902 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 78.180 | ||
aromaticity | 0.066 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.264 | ||
sheet | 0.283 |