Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344545.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
APVKVRFSFTIFMAIIFGSLFWKFGSKTEDTQDVMNAVGSMYASVLFLGFQYSSTVQPVVSVERTVFYRERAAGMYASLPYALSQLMIEIPYLLTQTVIYGLIVYAMIDFDWTAEKFFWF IYFLFISLLFYILYGMMTVAVTPNLSTATIVSAFFYGVWNLFSGFIIPKPRMPVWLRWYYWLSPTAYSIYGIIVSQYGEDDDLMNNGRTVRMYLKQTFWFRHNMLGMVASVFLLFVVVFT LVFAL | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 28,506.280 | ||
Theoretical pI: | 8.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 70820 70820 | ||
Instability index: | 36.440 | ||
aromaticity | 0.212 | ||
GRAVY | 0.674 | ||
Secondary Structure Fraction | |||
Helix | 0.482 | ||
turn | 0.188 | ||
sheet | 0.241 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY344545.1 | internal | 245 | 1-735(+) |
Amino Acid sequence : | |||
APVKVRFSFTIFMAIIFGSLFWKFGSKTEDTQDVMNAVGSMYASVLFLGFQYSSTVQPVVSVERTVFYRERAAGMYASLPYALSQLMIEIPYLLTQTVIYGLIVYAMIDFDWTAEKFFWF IYFLFISLLFYILYGMMTVAVTPNLSTATIVSAFFYGVWNLFSGFIIPKPRMPVWLRWYYWLSPTAYSIYGIIVSQYGEDDDLMNNGRTVRMYLKQTFWFRHNMLGMVASVFLLFVVVFT LVFAL | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 28,506.280 | ||
Theoretical pI: | 8.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 70820 70820 | ||
Instability index: | 36.440 | ||
aromaticity | 0.212 | ||
GRAVY | 0.674 | ||
Secondary Structure Fraction | |||
Helix | 0.482 | ||
turn | 0.188 | ||
sheet | 0.241 |