| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
| RYKEVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGT SLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWDIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
| PIQRSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGD KPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | complete | 125 | 424-47(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 110 | 796-464(-) |
Amino Acid sequence : | |||
| SLFPVLAGIASLHFFRISMHLSSLQSCNIPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 102 | 798-490(-) |
Amino Acid sequence : | |||
| HHFSRYSLESLLCISSEFLCIYRRSSHAISHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
| RYKEVQLHAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGT SLYLKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWDIA* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 129 | 1-390(+) |
Amino Acid sequence : | |||
| PIQRSSTSCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGD KPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | complete | 125 | 424-47(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 110 | 796-464(-) |
Amino Acid sequence : | |||
| SLFPVLAGIASLHFFRISMHLSSLQSCNIPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY344546.1 | 5prime_partial | 102 | 798-490(-) |
Amino Acid sequence : | |||
| HHFSRYSLESLLCISSEFLCIYRRSSHAISHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 10,829.038 | ||
| Theoretical pI: | 10.783 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 51.768 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.196 | ||
| turn | 0.392 | ||
| sheet | 0.216 | ||